PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC026849.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 292aa    MW: 32710 Da    PI: 6.5122
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC026849.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.45e-082272602154
                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   k +yp++e++++L +++gL+ +q+ +WF N+R +
  EcC026849.20 227 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 260
                   569*****************************87 PP

2ELK29.41.7e-10181202122
           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                   ELKh+L+++Y+++++++++E++
  EcC026849.20 181 ELKHELKQGYKEKIVDIREEIL 202
                   9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.6E-191256IPR005540KNOX1
PfamPF037901.5E-171554IPR005540KNOX1
SMARTSM012561.5E-2969124IPR005541KNOX2
PfamPF037911.2E-2173123IPR005541KNOX2
PROSITE profilePS512139.969181201IPR005539ELK domain
PfamPF037896.2E-7181202IPR005539ELK domain
SMARTSM011886.1E-4181202IPR005539ELK domain
PROSITE profilePS5007111.742201264IPR001356Homeobox domain
SuperFamilySSF466892.05E-16203267IPR009057Homeodomain-like
SMARTSM003892.2E-11203268IPR001356Homeobox domain
CDDcd000863.43E-12204263No hitNo description
Gene3DG3DSA:1.10.10.609.0E-26208266IPR009057Homeodomain-like
PfamPF059206.2E-18221260IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
DGVGALEDWR DARHKAEIVS HPLYEQLLSA HVACLRIATP VDQLPRIDSQ LAQSAQVVAK  60
YSALGAAAGH DGVGDDKELD QFMSHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ  120
SLTGVSPGQG TGATMSDDED DPIDSDVTLF DGGLDGPDSM GFGPLIPTET ERSLMERVRQ  180
ELKHELKQGY KEKIVDIREE ILRKRRAGKL PGDTTSVLKA WWQSHAKWPY PTEEDKAKLV  240
QETGLQLKQI NNWFINQRKR NWHSNSSSSS VSKSKRKRSL KIDCCLVNAK LP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257277RKRNWHSNSSSSSVSKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048153.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480001e-176KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A059CQ110.0A0A059CQ11_EUCGR; Uncharacterized protein
STRINGGLYMA04G06810.11e-176(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-148KNOTTED1-like homeobox gene 3